Analytical Data
-
Gene name
ADORA2A
-
简介
ADORA2A Protein-VLP, a receptor for adenosine, activates adenylyl cyclase through G proteins. Its direct interaction with USP4 and GAS2L2 in the cytoplasmic C-terminal domain suggests regulatory roles. Interactions with DRD4 and NECAB2 imply involvement in diverse cellular signaling pathways. ADORA2A Protein-VLP, Human (HEK293) is the recombinant human-derived ADORA2A protein-VLP, expressed by HEK293 , with tag free.
- Application
-
Alternative Names
ADORA2A; adenosine A2a receptor; ADORA2; adenosine receptor A2a; RDC8; adenosine A2 receptor; adenosine receptor subtype A2a; hA2aR;
-
Species
Human
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29274
-
Expression Region
M1-S412
-
AA Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADORA2A, or adenosine A2A receptor, is a G-protein coupled receptor that plays a crucial role in various physiological processes, including cardiovascular function, neurotransmission, and immune response. Its significance in neurological disorders, such as Parkinson's disease and schizophrenia, has led to increased interest in the development of ADORA2A-based therapies. Recent studies have shown that modulating ADORA2A activity can influence neuroprotection and neurotransmitter release, presenting potential therapeutic avenues for recovering neuronal function. The production of recombinant ADORA2A protein allows for detailed studies of its structure, function, and interactions with various ligands, enabling researchers to investigate its signaling pathways and therapeutic targets. Moreover, the recombinant protein can serve as a valuable tool for drug screening and development, facilitating the identification of novel compounds that can selectively modulate its activity. Understanding the molecular mechanisms underlying ADORA2A function is essential for designing innovative strategies to treat related disorders and improve patient outcomes. Overall, the research on ADORA2A recombinant protein is pivotal in advancing our knowledge of this receptor and its potential roles in various diseases, ushering in new possibilities for targeted therapeutics.
