Cat: PA1000-9309

Recombinant Human GDF10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GDF10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GDF10;BMP3B;Growth/differentiation factor 10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55107

  • Expression Region

    369-478aa

  • AA Sequence

    QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

  • Molecular Weight

    16.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GDF10 (Growth Differentiation Factor 10) is a member of the transforming growth factor-beta (TGF-β) superfamily, primarily known for its roles in cellular differentiation, growth regulation, and tissue homeostasis. Research has indicated that GDF10 plays a pivotal role in various biological processes, including neuroprotection, cardiac development, and anti-inflammatory responses. It has garnered attention for its potential therapeutic applications, particularly in neurodegenerative diseases and cardiovascular disorders. The recombinant form of GDF10 has been developed to enable detailed studies of its biological functions and mechanisms. Previous studies suggest that GDF10 can promote neuronal survival and has potential implications in enhancing neuronal repair mechanisms. Additionally, its anti-inflammatory properties may offer new avenues for treatments aimed at conditions characterized by excessive inflammation. The production of GDF10 as a recombinant protein allows for high-purity preparations suitable for in vitro and in vivo studies, facilitating the exploration of its therapeutic potential. Ongoing research is focused on elucidating the detailed signaling pathways involved in GDF10 action, optimizing its delivery methods, and assessing its efficacy in preclinical models. Through these efforts, GDF10 is being positioned as a promising candidate for developing novel therapies aimed at regenerative medicine and the treatment of diseases associated with cellular dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US