Analytical Data
-
Gene name
CHMP2B
- Application
-
Alternative Names
CHMP2B；Charged multivesicular body Protein 2b
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UQN3
-
Expression Region
1-213aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMASLFKKKTVDDVIKEQNRELRGTQRAIIR DRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSS KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQK ENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAK APSAARSLPSASTSKATISDEEIERQLKALGVD
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHMP2B, a pivotal component of the endosomal sorting complexes required for transport (ESCRT), has garnered considerable interest in neurodegenerative disease research, particularly in relation to frontotemporal dementia (FTD). Mutations in the CHMP2B gene have been linked to familial forms of FTD, highlighting its crucial role in cellular membrane trafficking and protein degradation pathways. Recent studies suggest that misfolding and aggregation of CHMP2B may disrupt the normal functioning of the ESCRT machinery, leading to impaired autophagy and increased susceptibility to neurotoxic protein accumulation. Investigating recombinant CHMP2B proteins allows researchers to better understand the protein's structural and functional properties, as well as how mutations affect its role in cellular processes. Furthermore, this research aims to elucidate the molecular mechanisms underlying FTD and may pave the way for potential therapeutic strategies targeting the ESCRT pathway, thereby offering hope for the development of interventions that could modify disease progression in affected individuals.
