Analytical Data
-
Gene name
GDF7
- Application
-
Alternative Names
GDF7；Growth/differentiation factor 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q75RY1
-
Expression Region
325-450aa
-
AA Sequence
TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPL DYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLS PISILYIDAANNVVYKQYEDMVVEACGCR
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GDF7, or Growth/Differentiation Factor 7, is a member of the transforming growth factor-beta (TGF-β) superfamily, primarily known for its roles in bone and cartilage development. Research on GDF7 has gained significant attention due to its potential therapeutic applications in regenerative medicine, particularly in tissue engineering and repair. It plays a crucial role in the differentiation of mesenchymal stem cells and has been shown to promote chondrogenesis, making it a valuable target for treating osteoarthritis and cartilage injuries. Additionally, GDF7 influences the development of sensory neurons, suggesting its involvement in pain modulation and neuroprotection. Consequently, the recombinant production of GDF7 is vital for conducting in vitro studies to explore its biological functions and therapeutic efficacy. Various expression systems, including bacterial, yeast, and mammalian cells, have been employed to produce functional GDF7 protein. Due to its complex post-translational modifications, particularly glycosylation, mammalian systems are preferred for optimal yields of bioactive GDF7. This research area focuses on understanding the signaling pathways mediated by GDF7 and its interactions with other growth factors, which could unlock new strategies for treating musculoskeletal disorders and enhancing tissue regeneration. Furthermore, the investigation into its mechanisms of action may lead to novel insights into pain management and peripheral nerve regeneration. As scientists continue to elucidate the multifaceted roles of GDF7, the recombinant protein will serve as an essential tool in preclinical and clinical studies aimed at leveraging its biological properties for therapeutic benefit.
