Analytical Data
-
Gene name
TADA3
- Application
-
Alternative Names
TADA3；ADA3；TADA3L；Transcriptional adapter 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75528
-
Expression Region
1-238aa
-
AA Sequence
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVD
-
Molecular Weight
53.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TADA3, or TAF(II) Dimethyltransferase 3, is a critical protein involved in transcriptional regulation and chromatin remodeling. Research on TADA3 has gained momentum due to its significant role in modulating gene expression through histone modification. As a member of the TAF complex, TADA3 interacts with other transcription factors and chromatin-remodeling complexes, thereby influencing the epigenetic landscape of cells. Its methyltransferase activity is essential for dimethylating lysine residues on histones, which can either activate or repress gene transcription depending on the context. Over the past few years, studies have begun to elucidate its involvement in various biological processes, including development, differentiation, and responses to environmental stresses. Moreover, aberrations in TADA3 expression and function have been linked to several diseases, including cancer, making it a potential target for therapeutic interventions. Recent advances in recombinant protein technology have enabled the production of TADA3 in vitro, facilitating detailed structural and functional analyses that provide insights into its mechanisms of action. Understanding the role of TADA3 in transcriptional regulation is critical for deciphering the complexities of gene expression and its implications in health and disease. Researchers continue to explore its potential as a biomarker or therapeutic target, highlighting the importance of TADA3 in the field of molecular biology and genomics.
