Analytical Data
-
Gene name
ZNF592
- Application
-
Alternative Names
ZNF592；KIAA0211；Zinc finger Protein 592
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92610
-
Expression Region
1-242aa
-
AA Sequence
MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL
-
Molecular Weight
53.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF592 (Zinc Finger Protein 592) is a member of the zinc finger protein family, characterized by its DNA-binding ability and potential roles in gene regulation and cellular processes. Research into ZNF592 has gained momentum due to its implications in various biological functions, including cell proliferation, differentiation, and responses to stress. Preliminary studies suggest that alterations in ZNF592 expression may be linked to disease states, particularly in neurodevelopmental disorders and certain types of cancer. The protein is believed to interact with other cellular factors, influencing transcriptional networks and signaling pathways pivotal to cell fate decisions. Given its strategic position within these networks, the recombinant expression of ZNF592 is critical for elucidating its functional roles and regulatory mechanisms. By expressing ZNF592 as a recombinant protein, researchers can investigate its structural properties, binding affinities, and functional assays to determine how its dysregulation may contribute to pathologies. Understanding ZNF592's precise mechanisms may pave the way for novel therapeutic strategies in diseases where this protein is implicated, thereby highlighting the importance of recombinant technology in advancing our knowledge of gene regulation and cellular dynamics.
