Analytical Data
-
Gene name
CF6
- Application
-
Alternative Names
CF6；C6orf51；General transcription factor 3C polypeptide 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18859
-
Expression Region
1-108aa
-
AA Sequence
NKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
-
Molecular Weight
36.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CF6 recombinant protein has garnered significant attention in the fields of molecular biology and biotechnology due to its potential applications in therapeutic development and antibody production. CF6, a member of the Cystatin family, plays a crucial role in regulating proteolytic enzymes, which are vital for various physiological processes such as immune response, tissue remodeling, and apoptosis. The study of CF6 is particularly relevant in understanding diseases where protease activity is dysregulated, such as cancer, inflammation, and neurodegenerative disorders. Advances in recombinant DNA technology have enabled the efficient production of CF6 proteins in host organisms, facilitating detailed biochemical studies and structural analyses. Research efforts have focused on elucidating the functional mechanisms of CF6, its interactions with target proteases, and its potential role as a biomarker or therapeutic agent. Furthermore, the development of CF6-based inhibitors or modulators could pave the way for novel treatments that leverage its regulatory functions. Collectively, the exploration of CF6 recombinant protein provides valuable insights into protease biology and opens new avenues for medical advancements.
