Analytical Data
-
Gene name
rpsC
- Application
-
Alternative Names
rpsC；ECF RNA polymerase sigma factor SigC
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A7V3
-
Expression Region
2-233aa
-
AA Sequence
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
-
Molecular Weight
52.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ribosomal protein S3 (RpsC) is a crucial component of the ribosomal machinery, playing a vital role in protein synthesis within prokaryotic organisms. As part of the 30S ribosomal subunit, RpsC is involved in the decoding of mRNA and the proper assembly of ribosomes, making it essential for translation accuracy and efficiency. The study of RpsC recombinant proteins has significant implications in understanding ribosome biogenesis, the mechanisms of antibiotic action, and the development of new therapeutic strategies. In particular, RpsC and its interactions with other ribosomal proteins and RNA are critical for the structural integrity and function of ribosomes. Through recombinant DNA technology, researchers have been able to produce RpsC in heterologous systems, allowing for detailed biophysical and biochemical characterization. This has led to insights into the protein’s structural features, conformational dynamics, and binding interactions with ribosomal RNA and other translational factors. Moreover, understanding the modifications and variations of RpsC among different bacterial species can shed light on evolutionary mechanisms and potential vulnerabilities that could be targeted in drug development. As antibiotic resistance continues to pose significant challenges in medicine, elucidating the role of RpsC in ribosomal function offers pathways to discover novel inhibitors that can combat resistant strains, thereby highlighting the importance of ongoing research into this pivotal ribosomal protein.
