Analytical Data
-
Gene name
EXOSC8
- Application
-
Alternative Names
EXOSC8；OIP2；RRP43;Exosome complex component RRP43
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96B26
-
Expression Region
1-276aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAAGFKTVEPLEYYRRFLKENCRPDGR ELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKG YVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCIS PGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETALA EVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMD EEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EXOSC8, a core component of the exosome complex, plays a crucial role in RNA metabolism, including degradation and processing of various RNA species. Its function is vital for maintaining cellular homeostasis and regulating gene expression. Mutations in the EXOSC8 gene have been linked to a range of disorders, including neurological diseases and certain syndromes characterized by developmental delays and other abnormalities. Given its significance, researchers have focused on studying the recombinant EXOSC8 protein to better understand its structure and function, as well as its interactions with other proteins within the exosome complex. The production of recombinant EXOSC8 allows for detailed biochemical characterization and functional assays, which can reveal insights into its role in RNA decay pathways and cellular responses to stress. Additionally, elucidating the mechanism by which EXOSC8 contributes to disease could lead to the development of potential therapeutic strategies for conditions associated with its dysfunction. Overall, the study of recombinant EXOSC8 not only enhances our understanding of fundamental cellular processes but also has important implications for medical research and therapeutic development.
