Analytical Data
-
Gene name
LOXL3
- Application
-
Alternative Names
LOXL3;LOXL;Lysyl oxidase homolog 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58215
-
Expression Region
526-753aa
-
AA Sequence
ETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSARSANWPYGHR RLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPN GTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDID CQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVH NCHIGDAFSEEANRRFERYPGQTSNQII
-
Molecular Weight
54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOXL3 (Lysyl Oxidase-Like 3) is a member of the lysyl oxidase family, enzymes that play a critical role in the extracellular matrix (ECM) remodeling and collagen cross-linking. Disruptions in LOXL3 expression and function have been implicated in various pathological conditions, notably in cancer progression, fibrosis, and cardiovascular diseases. Research has indicated that LOXL3 is involved in regulating cell adhesion, migration, and proliferation, indicating its potential role in tumorigenesis and metastasis. Therefore, the study of recombinant LOXL3 protein is of particular interest for understanding its biological functions and therapeutic potentials. Recombinant LOXL3 can be produced through various expression systems to study its enzymatic activity, substrate specificity, and interactions with other ECM components. This can provide insights into how LOXL3 contributes to tissue homeostasis and pathology. Additionally, understanding LOXL3's functional properties may reveal novel biomarkers for disease diagnosis or targets for therapeutic intervention, highlighting the importance of LOXL3 in both basic and translational research. Given the complexity of its mechanisms and the significance of ECM dynamics in numerous diseases, the exploration of LOXL3 holds promise for advancing our understanding of fibrotic and oncogenic processes.











