Analytical Data
-
Gene name
CX40
- Application
-
Alternative Names
CX40；Gap junction alpha-5 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36382
-
Expression Region
1-358aa
-
AA Sequence
MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
-
Molecular Weight
41.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The CX40 protein, also known as CXC chemokine ligand 40, plays a crucial role in various biological processes, including immune response, inflammation, and angiogenesis. It is a member of the chemokine family, which consists of small proteins that orchestrate the migration and activation of immune cells. The research surrounding CX40 has intensified due to its potential implications in various diseases, including cancer, cardiovascular disorders, and autoimmune conditions. Understanding the structure and function of CX40 could elucidate its specific roles in disease pathology and lead to the development of targeted therapies. Recent studies have focused on recombinant CX40 proteins, which allow researchers to explore the protein's properties, interactions with receptors, and signaling pathways in greater detail. These recombinant proteins facilitate the investigation of CX40's mechanistic pathways and its influence on cell behavior, opening up avenues for therapeutic interventions. Furthermore, the ability to produce CX40 recombinantly in a controlled environment enhances the feasibility of high-throughput screening for potential drugs that could modulate its activity. In essence, the study of CX40 recombinant protein serves not only to deepen our understanding of this critical chemokine but also to pave the way for innovative treatments targeting immune-related diseases.
