Cat: PA2000-3958

Recombinant E.coli VACWR150 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VACWR150

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VACWR150;Protein OPG154

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11258

  • Expression Region

    1-110aa

  • AA Sequence

    MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

  • Molecular Weight

    17.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VACWR150 is a recombinant protein derived from the Vibrio alginolyticus toxin, which has garnered significant interest in the field of infectious disease research due to its potential applications in vaccine development and therapeutic interventions. Vibrio alginolyticus is a bacterium known to cause gastrointestinal infections, particularly in immunocompromised individuals. The VACWR150 protein is part of ongoing studies aimed at understanding the immune response elicited by Vibrio infections. Researchers are investigating its structural properties, antigenicity, and the pathways through which it may trigger an immune response. By characterizing this protein, scientists hope to identify novel vaccine candidates that can offer protection against Vibrio-related diseases. Additionally, the recombinant nature of VACWR150 allows for its production in controlled laboratory settings, facilitating large-scale studies and enabling the assessment of its efficacy in preclinical models. As antibiotic resistance becomes a growing concern in treating bacterial infections, VACWR150 represents a promising avenue for developing new strategies to combat Vibrio infections, aiming to reduce morbidity and mortality rates associated with these illnesses. The exploration of VACWR150 not only enhances our understanding of host-pathogen interactions but also contributes to the broader field of immunology and vaccine research, paving the way for innovative therapeutic solutions in the fight against bacterial pathogens.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US