Analytical Data
-
Gene name
GSG1
- Application
-
Alternative Names
GSG1; UNQ709/PRO1360; Germ cell-specific gene 1 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q2KHT4
-
Expression Region
1-282aa
-
AA Sequence
MELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPGERCRSFIELTPPAKRGEKGLLEFATLQGPCHPTLRFGGKRLMEKASLPSPPLGLCGKNPMVIPGNADHLHRTSIHQLPPATNRLATHWEPCLWAQTERLCCCFLCPVRSPGDGGPHDVFTSLPSDCQLGSRRLETTCLELWLGLLHGLALLHLLHGVGCHHLQHVHQDGAGVQVQA
-
Molecular Weight
57.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GSG1, or G protein-coupled receptor 1, is a crucial protein involved in various cellular signaling pathways that regulate important physiological processes. Its role in mediating intracellular responses to hormonal or environmental stimuli has garnered significant attention in biomedical research. Given its involvement in key functions such as cell proliferation, differentiation, and apoptosis, understanding GSG1's structure and function can provide insights into various diseases, including cancer and metabolic disorders. Researchers have focused on recombinant protein technology to produce GSG1, enabling detailed studies of its biochemical properties and interactions with other cellular components. Recombinant GSG1 allows for the examination of its signaling mechanisms and potential as a therapeutic target. The study of GSG1 has implications for drug development, as modulation of its pathways could lead to innovative treatments for diseases influenced by G protein signaling. Through advancements in molecular biology techniques, the characterization of GSG1 and its functional analysis is advancing our understanding of its biological significance and potential clinical applications.
