Analytical Data
-
Gene name
PARP9
- Application
-
Alternative Names
PARP9；BAL；BAL1；Protein mono-ADP-ribosyltransferase PARP9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IXQ6
-
Expression Region
628-854aa
-
AA Sequence
IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD
-
Molecular Weight
30.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PARP9 (poly(ADP-ribose) polymerase 9) is a member of the PARP family, which is involved in various cellular processes, including DNA repair, apoptosis, and regulation of gene expression. Initially identified as a protein with mono(ADP-ribosyl) transferase activity, PARP9 has gained attention for its role in immune responses, particularly in the regulation of the primary immune effector molecules and the modulation of inflammatory pathways. Research has highlighted that PARP9 interacts with other proteins, such as histone and non-histone substrates, thereby influencing chromatin dynamics and cellular signaling. This makes PARP9 a potential target for therapeutic interventions in various diseases, including cancer and inflammatory disorders. The study of recombinant PARP9 protein is crucial for understanding its biochemical properties and mechanistic functions in cellular contexts. By producing PARP9 in a recombinant system, researchers can investigate its enzymatic activities, binding affinities, and interactions with other cellular components. This knowledge may provide insights into the development of PARP inhibitors that could enhance the efficacy of cancer treatments, particularly in tumors that exhibit resistance to conventional therapies. Furthermore, the characterization of PARP9 could unveil novel regulatory pathways and contribute to the design of targeted therapies aimed at modulating immune responses in diseases involving chronic inflammation or autoimmunity. Overall, the exploration of PARP9, particularly in its recombinant form, promises to deepen our understanding of its biological significance and potential as a therapeutic target.
