Cat: PA1000-1316

Recombinant Human GPNMB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GPNMB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GPNMB;HGFIN;NMB;Transmembrane glycoProtein NMB

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14956

  • Expression Region

    22-474aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSAKRFHDVLGNERPSAYMREHNQLNGWS SDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAV NLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGT GQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNT ANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDR NSSDETFLKDLPIMFDVLIHDPSHFLNYSTINYKWSFGDNTGLFVSTNHT VNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLGPAGDNPLE LSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLI DFVVTCQGSIPTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNG SGTYCVNLTLGDDTSLALTSTLISVP

  • Molecular Weight

    53 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPNMB (glycoprotein non-metastatic B) is a transmembrane glycoprotein that has garnered significant interest in cancer research due to its dual role in tumors and immune regulation. Initially identified as a protein linked to melanoma metastasis, GPNMB is now recognized for its involvement in various tumor types, including breast, lung, and colon cancers. Overexpression of GPNMB in these malignancies is often associated with aggressive tumor behavior and poor prognosis, making it a potential biomarker for metastatic disease. Furthermore, GPNMB plays a crucial role in modulating the immune response, influencing both innate and adaptive immunity. Its expression in immune cells, particularly in macrophages and dendritic cells, suggests that it could serve as a target for immunotherapy. The development of recombinant GPNMB proteins aims to elucidate its functional roles in cancer progression and immune modulation. By studying the structural and biochemical properties of GPNMB, researchers hope to better understand its mechanisms of action and explore its potential as a therapeutic target or diagnostic marker. As a result, GPNMB continues to be a focal point of research aimed at developing new cancer treatments and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US