Analytical Data
-
Gene name
GTF2H5
- Application
-
Alternative Names
GTF2H5;C6orf175;TTDA;General transcription factor IIH subunit 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZYL4
-
Expression Region
1-71aa
-
AA Sequence
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK
-
Molecular Weight
35.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GTF2H5, a subunit of the general transcription factor IIH (TFIIH) complex, plays a crucial role in the regulation of gene expression and DNA repair mechanisms. TFIIH is a multi-protein complex involved in the transcription initiation of protein-coding genes and the nucleotide excision repair of DNA. GTF2H5 specifically contributes to the assembly of TFIIH and is essential for its helicase activity, which unwinds DNA strands during transcription. Dysregulation or mutations in GTF2H5 can lead to various diseases, including cancer and disorders related to DNA repair deficiencies. Research on the recombinant form of GTF2H5 focuses on its structural and functional analysis to better understand its role in transcription and DNA repair pathways. The recombinant protein can be used for biochemical assays, protein-protein interaction studies, and structural determinations, which are vital for elucidating the mechanisms of transcription regulation and the repair processes of damaged DNA. Understanding GTF2H5 at the molecular level may also provide insights into therapeutic targets for diseases associated with its dysfunction, making it an important focus within molecular biology and genetics research.
