Analytical Data
-
Gene name
DIP2C
- Application
-
Alternative Names
DIP2C；KIAA0934；Disco-interacting Protein 2 homolog C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2E4
-
Expression Region
1-125aa
-
AA Sequence
MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSM
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DIP2C, or Divergent Immunoglobulin Protein 2C, is a member of the immunoglobulin superfamily that has gained attention in the field of molecular biology and immunology due to its potential roles in immune responses and cell signaling. Research in recent years has highlighted the structural and functional characteristics of DIP2C, suggesting that it may be involved in modulating immune system activities, particularly in various diseases such as cancer and autoimmune disorders. The exploration of DIP2C as a recombinant protein offers the potential to better understand its biological functions, interactions with other cellular components, and its implications in therapeutic applications. Recombinant technologies allow for the production of DIP2C in a host system, enabling detailed studies of its properties, including ligand binding and receptor interactions. Such studies are crucial for elucidating the protein's role in immune regulation and may lead to the development of novel therapeutic strategies aimed at enhancing immune responses or targeting specific cellular pathways. Overall, the investigation of DIP2C not only contributes to our understanding of immune biology but also opens new avenues for research in disease treatment and management.
