Analytical Data
-
Gene name
A143V
- Application
-
Alternative Names
A143V；Virion membrane Protein OPG143
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16710
-
Expression Region
1-377aa
-
AA Sequence
MGAAVTLNRIKIAPGIADIRDKYMELGFNYPEYNRAVKFAEESYTYYYETSPGEIKPKFCLIDGMSIDHCSSFIVPEFAKQYVLIHGEPCSSFKFRPGSLIYYQNEVTPEYIKDLKHATDYIASGQRCHFIKKDYLLGDSDSVAKCCSKTNTKHCPKIFNNNYKTEHCDDFMTGFCRNDPGNPNCLEWLRAKRKPAMSTYSDICSKHMDARYCSEFIRIIRPDYFTFGDTALYVFCNDHKGNRNCWCANYPKSNSGDKYLGPRVCWLHECTDESRDRKWLYYNQDVQRTRCKYVGCTINVNSLALKNSQAELTSNCTRTTSAVGDVHPGEPVVKDKIKLPTWLGAAITLVVISVIFYFISIYSRPKIKTNDINVRRR
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The A143V recombinant protein is derived from the study of the avian influenza virus (AIV), particularly focusing on its hemagglutinin (HA) gene. As mutations in AIV are known to influence viral infectivity and host range, the A143V substitution in the HA protein has garnered significant interest. Research has indicated that this mutation may enhance the virus's ability to bind to sialic acid receptors found in different hosts, including humans and other mammals. Understanding the molecular mechanisms behind this mutation is crucial for assessing the potential zoonotic risk of AIV strains and their capacity to cause pandemics. The A143V variant has been studied using various techniques, including recombinant DNA technology and bioinformatics, to analyze structural and functional changes in the HA protein. Such insights are vital for public health surveillance, vaccine development, and antiviral strategies, as they can inform the risks posed by emerging AIV variants and guide health responses to potential outbreaks. By elucidating the characteristics of the A143V recombinant protein, researchers aim to provide a framework for better understanding AIV evolution and its implications for animal and human health.
