Analytical Data
-
Gene name
LYPLA2
- Application
-
Alternative Names
LYPLA2;APT2;Acyl-Protein thioesterase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95372
-
Expression Region
1-231aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMCGNTMSVPLLTDAATVSGAERETAAVIFL HGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMG LSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY TALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPP V
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Lipopolysaccharide (LPS) is a critical component of the outer membrane of Gram-negative bacteria, playing a pivotal role in eliciting strong immune responses. The enzyme lysophospholipase 2 (LYPLA2) has garnered attention for its potential role in modulating these immune responses. Research indicates that LYPLA2 can hydrolyze lysophospholipids, which are bioactive lipids that influence cell signaling and immune cell activation. Additionally, LYPLA2 has been linked to various pathological conditions, including inflammatory diseases and cancer, making it a valuable target for therapeutic intervention. The production of recombinant LYPLA2 protein has enabled detailed studies into its structure, function, and interactions with other biomolecules. By characterizing this enzyme, researchers aim to elucidate its physiological and pathological roles, providing insights into the modulation of immune responses. Understanding the precise mechanisms by which LYPLA2 affects cellular signaling pathways could lead to novel therapeutic strategies for diseases characterized by dysregulated inflammation. Thus, the recombinant expression and characterization of LYPLA2 not only advance our fundamental understanding of lipid metabolism and immune regulation but also hold promise for developing innovative treatments for various immune-related disorders.
