Analytical Data
-
Gene name
M6PR
- Application
-
Alternative Names
M6PR;MPR46;MPRD;Cation-dependent mannose-6-phosphate receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20645
-
Expression Region
27-185aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSTEEKTCDLVGEKGKESEKELALVKRLK PLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVV GRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLADN FNPVSEERGKVQDCFYLFEMDSSLACSPEISH
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
M6PR (mannose-6-phosphate receptor) is a critical protein involved in the recognition and transport of lysosomal enzymes. Research into M6PR has gained momentum due to its pivotal role in cellular function and potential implications in various diseases. Historically, M6PR was identified as a receptor that facilitates the delivery of enzymes marked with mannose-6-phosphate to lysosomes, crucial for cellular degradation of macromolecules. Dysregulation of M6PR has been implicated in lysosomal storage disorders, neurodegenerative diseases, and cancer. Recent studies have aimed to elucidate the molecular mechanisms governing M6PR’s function and its interactions with other cellular components. Advanced techniques, such as CRISPR-Cas9 genome editing and in vivo imaging, have been employed to explore the receptor's role in cellular trafficking and its impact on tissue homeostasis. Moreover, researchers are investigating M6PR as a potential therapeutic target, with the hope that modulation of its activity could alleviate symptoms associated with lysosomal dysfunction. Understanding the detailed structure and function of M6PR is essential for developing novel approaches to treat related pathologies, emphasizing the importance of continued research in this area.
