Analytical Data
-
Gene name
MAPRE1
- Application
-
Alternative Names
MAPRE1;Microtubule-associated Protein RP/EB family member 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15691
-
Expression Region
2-268aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHENLYFQGGEFAVNVYSTSVTSDNLSRHDMLA WINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYI QNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGK DYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAA PKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLR NIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAPRE1, also known as microtubule-associated protein RP/EB family member 1, is an essential protein that plays a pivotal role in microtubule dynamics, specifically in the regulation of the cytoskeleton. It is involved in various cellular processes including cell division, intracellular transport, and signal transduction, making it crucial for maintaining cellular integrity and function. Research has indicated that MAPRE1 is associated with several types of cancers and neurological disorders, highlighting its potential role as a biomarker and therapeutic target. The protein binds to the plus ends of microtubules, promoting their stabilization and facilitating cellular structural organization. Understanding the interactions and modifications of MAPRE1 can provide insights into the mechanisms underlying its involvement in disease. Recent studies focus on characterizing MAPRE1 through recombinant protein expression, enabling detailed exploration of its structural and functional properties. This research could advance our understanding of microtubule dynamics and potentially reveal new avenues for therapeutic interventions in diseases associated with dysregulated cytoskeletal dynamics. As a result, MAPRE1 represents a critical molecular target for further investigation within both cancer biology and neurobiology, with the potential to contribute to the development of novel strategies for diagnosis and treatment.
