Analytical Data
-
Gene name
MFNG
- Application
-
Alternative Names
MFNG；Beta-1.3-N-acetylglucosaminyltransferase manic fringe
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00587
-
Expression Region
1-321aa
-
AA Sequence
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR
-
Molecular Weight
36.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of MFNG (Mindbomb E3 ubiquitin protein ligase) recombinant proteins is rooted in the crucial role these proteins play in the Notch signaling pathway, which is essential for various cellular processes, including differentiation, proliferation, and survival. Disruptions in Notch signaling have been implicated in numerous diseases, particularly cancer, making MFNG a significant focus of research. MFNG is known for its E3 ligase activity, which promotes the ubiquitination and subsequent degradation of proteins involved in the Notch pathway, thereby regulating its activity. Understanding the structural and functional properties of MFNG through the production of recombinant proteins can provide insights into its mechanism of action and interactions with other molecular players in the pathway. This research is further motivated by the potential therapeutic implications; by modulating MFNG function, it might be possible to influence Notch signaling and develop novel treatments for diseases characterized by aberrant signaling, such as certain leukemias and solid tumors. Consequently, recombinant MFNG proteins serve not only as valuable tools for dissecting the biochemistry of the Notch pathway but also as promising candidates for innovative therapeutic interventions.
