Analytical Data
-
Gene name
ELOA3DP
- Application
-
Alternative Names
ELOA3DP
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NLF2
-
Expression Region
270-429aa
-
AA Sequence
LWDPSEAWMQANYDLLSAFEAMTSQANPEALSAPTLQEEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCLRVPRNNPDALGDVEGVPYSALEPVLEGWTPDQPYRTEKDNAALARETDELWRIHCLQDFKEEKPQEHESWRELYLRLRDAREQRLRV
-
Molecular Weight
25.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ELOA3DP, a recombinant protein derived from the ELOA gene family, has garnered significant interest in the field of molecular biology and biotechnology due to its potential applications in therapeutic development and protein engineering. This protein is known for its unique structural features and functional properties, which may play a crucial role in various biological processes, including cellular signaling and metabolic regulation. Research into ELOA3DP has primarily focused on elucidating its role in disease mechanisms, particularly in conditions where cellular dysregulation occurs. Moreover, its ability to interact with other biomolecules positions it as a promising candidate for the development of novel therapeutic agents. The recombinant production of ELOA3DP allows for enhanced yield and purity, making it easier to conduct detailed studies on its properties and functions. As the demand for innovative biopharmaceuticals grows, understanding the functionality and therapeutic potential of ELOA3DP is essential, paving the way for advancements in targeted therapies and personalized medicine. Overall, the research surrounding ELOA3DP not only contributes to our understanding of fundamental biological processes but also holds promise for tangible benefits in medical science.
