Analytical Data
-
Gene name
LMO3
- Application
-
Alternative Names
DAT 1; DAT1; LIM domain only 3 (rhombotin like 2); LIM domain only protein 3; LMO 3; LMO-3; lmo3; LMO3_HUMAN; MGC26081; Neuronal specific transcription factor DAT1; Neuronal-specific transcription factor DAT1; RBTN 3; RBTN3; RBTNL 2; RBTNL2; RHOM 3; RHOM3; Rhombotin 3; Rhombotin like 2; Rhombotin-3; Rhombotin3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAP4
-
Expression Region
1-145aa
-
AA Sequence
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
-
Molecular Weight
41.69 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LMO3 (LIM domain only 3) is a member of the LIM domain protein family, which plays a critical role in various biological processes, including neuronal development, cell differentiation, and tumorigenesis. Research into LMO3 has gained considerable attention due to its involvement in the regulation of gene expression through interactions with transcription factors and other nuclear proteins. Abnormal expression or function of LMO3 has been implicated in several neurological disorders and cancers, making it a potential target for therapeutic intervention. To better understand its biological functions and mechanisms, researchers have focused on the production and characterization of recombinant LMO3 protein. This approach facilitates the investigation of its structural features, interactions with other proteins, and regulatory roles in cellular pathways. By utilizing techniques such as protein purification, crystallization, and binding assays, scientists aim to elucidate the molecular basis of LMO3’s action and its potential as a biomarker or therapeutic target in disease contexts. Overall, the study of recombinant LMO3 protein contributes valuable insights into the functional significance of this LIM domain protein and its implications in health and disease.
