Cat: PA1000-2097

Recombinant Human NCF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NCF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NCF1;NOXO2;SH3PXD1A;Neutrophil cytosol factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14598

  • Expression Region

    1-390aa

  • AA Sequence

    MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEF HKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCST LMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTAT DITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKA KRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEG EAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPP RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAVVEHHHHHH

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NCF1, or Neutrophil Cytosolic Factor 1, is a crucial component of the NADPH oxidase complex, which plays a significant role in the immune response by producing reactive oxygen species (ROS). The research on NCF1 recombinant protein has gained prominence due to its essential function in phagocyte activation and microbial elimination. Mutations or deficiencies in the NCF1 gene are linked to Chronic Granulomatous Disease (CGD), a genetically inherited condition that predisposes individuals to recurrent bacterial and fungal infections. Understanding the structure and function of NCF1 is vital for developing targeted therapies for CGD and related disorders. The recombinant production of NCF1 allows researchers to investigate its biochemical properties, interaction with other proteins in the oxidase complex, and its regulatory mechanisms. Additionally, recombinant NCF1 can serve as a valuable tool for in vitro studies to explore the pathways involved in oxidative burst and immune response. This research not only enhances our comprehension of innate immunity but also opens avenues for therapeutic interventions in CGD and potentially other immune-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US