Analytical Data
-
Gene name
NCEH1
- Application
-
Alternative Names
NCEH1;AADACL1;KIAA1363;Neutral cholesterol ester hydrolase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PIU2
-
Expression Region
26-408aa
-
AA Sequence
SVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
-
Molecular Weight
50.7KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NCEH1 (Neutral Cholesterol Ester Hydrolase 1) is a significant enzyme implicated in lipid metabolism and has garnered interest due to its role in various physiological and pathological processes, including inflammation, cardiovascular diseases, and metabolic disorders. As a member of the serine hydrolase family, NCEH1 is primarily involved in the hydrolysis of cholesterol esters, thereby regulating the levels of free cholesterol and impacting cellular lipid homeostasis. The enzyme's function is particularly crucial in the context of macrophage foam cell formation, which is a key event in atherosclerosis development. Recent studies have highlighted the potential of NCEH1 as a therapeutic target, given its ability to modulate inflammatory responses and contribute to the resolution of lipid accumulation. Understanding the structure and function of recombinant NCEH1 can offer insights into its enzymatic mechanisms and interaction with substrates and inhibitors. The development of recombinant NCEH1 allows for in-depth investigations into the enzyme's kinetics and its role in lipid-related diseases, paving the way for novel therapeutic strategies aimed at enhancing lipid metabolism and reducing cardiovascular risk. As research continues, elucidating the biochemical pathways involving NCEH1 could provide critical knowledge necessary for the design of specific modulators that harness its lipid-regulatory functions, ultimately contributing to improved health outcomes.
