Analytical Data
-
Gene name
GLP2
- Application
-
Alternative Names
GLP2；Glucagon-like peptide 2 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01275
-
Expression Region
53-89aa
-
AA Sequence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
-
Molecular Weight
6.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Glucagon-like peptide-2 (GLP-2) is an intestinal incretin hormone predominantly secreted by L-cells in the gut in response to nutrient intake. It plays a significant role in promoting intestinal growth, enhancing mucosal integrity, and regulating food intake, making it a focus of research for gastrointestinal health and metabolic disorders. Recombinant GLP-2 protein has garnered attention for its potential therapeutic applications in conditions such as short bowel syndrome, inflammatory bowel disease, and other gastrointestinal diseases characterized by mucosal damage and malabsorption. Studies have shown that GLP-2 can stimulate intestinal epithelial cell proliferation, increase intestinal blood flow, and reduce gastric emptying, contributing to improved nutrient absorption and overall gut function. The development of recombinant GLP-2 has enabled detailed investigations into its pharmacological effects and mechanisms of action, paving the way for innovative treatments aimed at enhancing intestinal health and managing metabolic syndromes. Given the growing prevalence of gastrointestinal disorders and the demand for effective therapies, the exploration of GLP-2 as a recombinant protein underscores its potential to revolutionize the management of these conditions, offering new avenues for improving patient outcomes and quality of life. The ongoing research surrounding GLP-2 continues to elucidate its complex roles in the gastrointestinal system and to justify the development of synthetic analogs for clinical use.
