Cat: PA2000-8927

Recombinant Human LMO7 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LMO7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    F box only protein 20; F box protein Fbx20; F-box only protein 20; FBX20; FBXO20; HGNC13591; KIAA0858; LIM domain only 7; LIM domain only protein 7; LMO 7; LMO-7; LMO7; LMO7_HUMAN; LOMP; LOMP protein; Zinc finger domain containing protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WWI1

  • Expression Region

    453-540aa

  • AA Sequence

    DRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSP

  • Molecular Weight

    35.42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LMO7 (LIM domain only 7) is a member of the LIM domain protein family, which is known for its roles in cellular processes such as signal transduction, cytoskeleton organization, and transcriptional regulation. Recent studies have indicated that LMO7 plays a crucial role in development and tissue homeostasis, particularly in muscle and nerve tissues. Its involvement in signaling pathways also suggests potential implications in cancer biology and other diseases. The reorganization of LMO7 through recombinant protein technology allows researchers to better understand its structure-function relationships and interactions with other cellular components. Investigating LMO7 as a recombinant protein can provide insights into its mechanistic roles in cellular processes and its potential as a therapeutic target. Given the importance of LIM domain proteins in various biological contexts, the study of LMO7 not only contributes to our understanding of fundamental cellular mechanisms but also opens avenues for novel interventions in diseases linked to its dysregulation. 

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US