Analytical Data
-
Gene name
LMO7
- Application
-
Alternative Names
F box only protein 20; F box protein Fbx20; F-box only protein 20; FBX20; FBXO20; HGNC13591; KIAA0858; LIM domain only 7; LIM domain only protein 7; LMO 7; LMO-7; LMO7; LMO7_HUMAN; LOMP; LOMP protein; Zinc finger domain containing protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWI1
-
Expression Region
453-540aa
-
AA Sequence
DRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSP
-
Molecular Weight
35.42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LMO7 (LIM domain only 7) is a member of the LIM domain protein family, which is known for its roles in cellular processes such as signal transduction, cytoskeleton organization, and transcriptional regulation. Recent studies have indicated that LMO7 plays a crucial role in development and tissue homeostasis, particularly in muscle and nerve tissues. Its involvement in signaling pathways also suggests potential implications in cancer biology and other diseases. The reorganization of LMO7 through recombinant protein technology allows researchers to better understand its structure-function relationships and interactions with other cellular components. Investigating LMO7 as a recombinant protein can provide insights into its mechanistic roles in cellular processes and its potential as a therapeutic target. Given the importance of LIM domain proteins in various biological contexts, the study of LMO7 not only contributes to our understanding of fundamental cellular mechanisms but also opens avenues for novel interventions in diseases linked to its dysregulation.











