Analytical Data
-
Gene name
CITED1
- Application
-
Alternative Names
CITED1;MSG1;Cbp/p300-interacting transactivator 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99966
-
Expression Region
1-193aa
-
AA Sequence
MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGV ASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKL NSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDS DPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
-
Molecular Weight
47 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CITED1 (CBP/p300-interacting transactivator with Glu/Asp-rich carboxy-terminal domain 1) is a transcriptional co-activator that plays a crucial role in various biological processes, including cell differentiation, proliferation, and development. Its importance has been underscored by its involvement in key pathways such as the hypoxia-inducible factor (HIF) signaling, which is critical in cancer biology and tissue response to oxygen levels. Aberrant expression of CITED1 has been associated with several types of cancer, indicating that it may serve as a potential biomarker and therapeutic target. Research has focused on understanding the structural and functional characteristics of CITED1, particularly its interactions with other proteins and transcription factors like CBP and p300. Recombinant CITED1 proteins have been produced for experimental purposes, facilitating studies on its role in transcription regulation and the mechanistic pathways it influences. These investigations are pivotal for elucidating the precise functions of CITED1, which could contribute to the development of innovative therapeutic strategies targeting diseases linked to its dysregulation.











