Analytical Data
-
Gene name
NME4
- Application
-
Alternative Names
GRIN2D;GluN2D;NMDAR2D;Glutamate receptor ionotropic. NMDA 2D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00746
-
Expression Region
33-187aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRF ERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVW EGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQR EIQLWFQSSELVSWADGGQHSSIHPA
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NME4, a member of the nucleoside diphosphate kinase (NME) family, plays a significant role in cellular energy metabolism and signaling pathways. NME proteins are known for their ability to convert nucleoside diphosphates (NDPs) into nucleoside triphosphates (NTPs), thereby participating in essential biological processes such as cell proliferation, differentiation, and apoptosis. Research on NME4 has gained attention due to its potential links to various diseases, particularly cancer, where altered expression levels have been associated with tumor progression and metastasis. Unlike its better-studied counterparts, NME1 through NME3, NME4's precise functions in biological systems remain less understood, prompting investigations into its structural characteristics and enzymatic activity. Recent studies have suggested that NME4 may have distinct regulatory roles beyond its kinase activity, including involvement in cellular localization and interactions with various proteins. Moreover, understanding the molecular mechanisms behind NME4's functions could provide insights into novel therapeutic strategies for malignant diseases. The recombinant expression of NME4 is a critical step for further biochemical characterization and the development of inhibitors or activators that can modulate its activity, offering promising avenues for cancer treatment research.
