Analytical Data
-
Gene name
LYPLAL1
- Application
-
Alternative Names
BC027340; FLJ99730; KIAA1238; LYPL1_HUMAN; LYPLAL1; Lysophospholipase like 1; Lysophospholipase-like protein 1; MGC28394; OTTHUMP00000035229
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VWZ2
-
Expression Region
1-237aa
-
AA Sequence
MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK
-
Molecular Weight
52.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYPLAL1, a protein encoded by the LYPLAL1 gene, belongs to the lipid-binding protein family and is implicated in various biological processes, including lipid metabolism and signal transduction. Recent studies have highlighted the potential role of LYPLAL1 in cancer progression and metabolic disorders, making it a target of considerable interest for therapeutic development. Its expression levels have been linked to tumorigenesis, suggesting that LYPLAL1 may serve as a novel biomarker for certain cancers. Research has focused on the recombinant production of LYPLAL1 to facilitate functional characterization and the exploration of its biochemical properties. Utilizing various expression systems, such as bacterial and eukaryotic platforms, researchers aim to produce sufficient quantities of LYPLAL1 for structural studies and potential drug development. Understanding the conformational dynamics and interaction mechanisms of LYPLAL1 with other biomolecules could pave the way for innovative approaches to modulate its activity in disease contexts. As the landscape of precision medicine evolves, LYPLAL1's role in lipid homeostasis and its impact on cellular signaling pathways continues to attract attention, underscoring the need for ongoing research into its biological functions and therapeutic implications.
