Analytical Data
-
Gene name
LYRM1
- Application
-
Alternative Names
1110065L10Rik; 2310004B22Rik; 4930404J24Rik; A211C6.1; LYR motif containing 1; LYR motif containing protein 1; LYR motif-containing protein 1; LYRM 1; lyrm1; LYRM1_HUMAN; OTTHUMP00000162292; OTTMUSP00000031126; OTTMUSP00000031127; OTTMUSP00000031128; OTTMUSP00000031129; RGD1563498
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43325
-
Expression Region
1-122aa
-
AA Sequence
MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRPIHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDEVS
-
Molecular Weight
13.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYRM1, or LYR Motif Containing 1, is a gene that encodes a protein involved in various cellular processes, particularly those related to mitochondrial function and the assembly of mitochondrial respiratory complexes. Research has highlighted its potential role in the regulation of oxidative phosphorylation and energy metabolism, which are critical for cellular homeostasis and function. LYRM1 has also been linked to several pathological conditions, including neurodegenerative diseases and metabolic disorders, indicating its potential as a biomarker or therapeutic target. Recent studies have focused on the structural and functional characterization of LYRM1 and its interactions with other mitochondrial proteins, which can provide insights into its mechanisms of action and regulatory functions. The recombinant expression of LYRM1 protein has become a crucial tool for further investigation, enabling researchers to explore its biochemical properties, interaction partners, and potential implications in mitochondrial dysfunction. Understanding the role of LYRM1 at a molecular level could deepen our knowledge of mitochondrial biology and its impact on human health, paving the way for the development of novel interventions in diseases where mitochondrial dysfunction plays a pivotal role. As research progresses, LYRM1 represents a promising area of inquiry with the potential to unveil new therapeutic strategies aimed at restoring mitochondrial integrity and function in affected individuals.
