Analytical Data
-
Gene name
SLC25A6
- Application
-
Alternative Names
SLC25A6;AAC3;ANT3;ADP/ATP translocase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12236
-
Expression Region
232-272aa
-
AA Sequence
DTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFK
-
Molecular Weight
20.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A6, a member of the solute carrier (SLC) family of proteins, encodes for the mitochondrial carrier protein involved in the transport of various metabolites across the inner mitochondrial membrane. Its primary function is to transport carnitine and acylcarnitines, playing a crucial role in fatty acid oxidation and cellular energy metabolism. Mutations in the SLC25A6 gene have been implicated in a range of metabolic disorders, including mitochondrial diseases and certain forms of cardiomyopathy. The study of SLC25A6 recombinant proteins has become increasingly important to understand its structural and functional properties, as well as the molecular mechanisms underlying its transport activities. By producing and characterizing recombinant SLC25A6 proteins in various expression systems, researchers aim to explore the impact of specific mutations on protein function, investigate the regulatory mechanisms of transporter activity, and develop potential therapeutic strategies for diseases associated with SLC25A6 dysfunction. Additionally, the structural elucidation of SLC25A6 may provide insights into the transport mechanisms utilized by other members of the mitochondrial carrier family, enhancing our understanding of mitochondrial biology and metabolism as a whole. As mitochondrial dysfunction is linked to numerous health conditions, such as obesity, diabetes, and neurodegenerative diseases, elucidating the role of SLC25A6 offers promising avenues for developing targeted therapies and improving metabolic health.











