Analytical Data
-
Gene name
OAS1
- Application
-
Alternative Names
OAS1;OIAS;2'-5'-oligoadenylate synthase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00973
-
Expression Region
1-400aa
-
AA Sequence
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OAS1 (2'-5' oligoadenylate synthetase 1) is a key enzyme in the antiviral response, primarily known for its role in the innate immune system. It catalyzes the synthesis of 2'-5' oligoadenylates from ATP, which activates RNase L, leading to the degradation of viral RNA and inhibition of viral replication. Research on OAS1 has gained traction due to its potential implications in understanding various viral infections, autoimmune diseases, and inflammatory responses. Variants of the OAS1 gene have been associated with differing susceptibility to viral infections, including COVID-19, highlighting its importance in host defense mechanisms. The recombinant production of OAS1 protein allows for in-depth functional studies, characterization of its enzymatic activity, and investigation of its interactions with other cellular components. Moreover, given its role in mediating antiviral actions, OAS1 serves as a promising target for therapeutic interventions against viral diseases. Studies involving the recombinant OAS1 protein not only deepen our understanding of its biochemical pathways and regulatory mechanisms but also facilitate the exploration of its potential utility in vaccine development and treatment strategies for viral infections. By leveraging the advances in molecular biology and protein engineering, researchers aim to elucidate the complex role of OAS1 in immune responses, potentially leading to novel approaches in enhancing antiviral therapy.
