Analytical Data
-
Gene name
MGC45800
- Application
-
Alternative Names
cDNA FLJ14238 fis. clone NT2RP4000519
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B3KNC5
-
Expression Region
1-148 aa
-
AA Sequence
MGDLSRTALWLGGRRDPSGSFRVRDGAAAEVGRACLGLPSECGSLVRARASPRPLLGPAVGPWRARSPRPGLPRPSPTCPWKRGGDWCALSLVAPAASRHPPLSASEQRIPPTSTCTCTRPLGNPLAFLTTVQNQKQIEHWENKDDAS
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGC45800 is a recombinant protein that has garnered significant interest in the field of biotechnology and pharmaceutical research. The protein is derived from a biologically relevant source, making it a focal point for studies aimed at understanding its structure-function relationships and potential applications in therapeutics. Given its unique properties, MGC45800 is being investigated for its role in various biological processes, including cell signaling, immune response modulation, and disease pathogenesis. Its potential as a therapeutic agent is particularly noteworthy, as researchers explore its efficacy in treating conditions such as cancer, autoimmune diseases, and metabolic disorders. The recombinant nature of MGC45800 allows for controlled production and purification, enabling detailed studies on its biochemical characteristics and interactions with other molecular entities. Advances in recombinant DNA technology have facilitated the production of MGC45800 in heterologous systems, ensuring a robust yield and functional integrity of the protein. The ongoing research into MGC45800 not only aims to unveil its physiological roles but also to translate these findings into practical therapeutic applications. The protein’s prospects are bolstered by its compatibility with various drug delivery systems, potentially enhancing the effectiveness of treatment modalities. As such, MGC45800 represents a promising candidate in the expanding landscape of biopharmaceuticals, where understanding the nuances of recombinant proteins is vital for the development of novel therapies that address unmet medical needs.
