Analytical Data
-
Gene name
MGC39545
- Application
-
Alternative Names
Putative uncharacterized protein MGC39545
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IYB0
-
Expression Region
1-196 aa
-
AA Sequence
MPSGEERRDRQKGRRAGCDTSSTPSNTAPRIPEPGAHPTAARPATAQPPRSLLPPVCSKTIAPPASAAAASGSDTAGMRGLGKAPHSGEGHERGRGNSKMKACNNYQYGYLAKPDTSFWIKCRRWLLADAGRHTQRPFWTFRVSHSPLLEAEAGRPSDVSQLQLGSDLKPKMRRPAGELFSPKDAGWELDPAEKSE
-
Molecular Weight
47.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGC39545 is a recombinant protein that has garnered attention in the field of molecular biology due to its potential role in various cellular processes and functions. Originally identified from a cDNA library, MGC39545 is believed to be involved in mechanisms related to cellular signaling and gene regulation. Its structure and function are of interest in the context of disease research, particularly in cancer and metabolic disorders, as proteins like MGC39545 can influence cell growth, differentiation, and response to stimuli. Studies have indicated that its expression levels may correlate with specific pathological conditions, making it a promising candidate for further exploration as a biomarker or therapeutic target. Researchers are increasingly focused on characterizing its biochemical properties, understanding its interactions with other proteins, and elucidating its functional pathways. The use of recombinant technology has facilitated the production of MGC39545 in sufficient quantities for detailed biochemical assays and structural analysis, paving the way for a comprehensive understanding of its biological significance. This has the potential to unveil novel insights into cellular mechanisms and contribute to the development of innovative therapeutic strategies aimed at modulating its function in disease contexts. As research progresses, MGC39545 may reveal itself as a valuable contributor to our understanding of complex biological systems.
