Analytical Data
-
Gene name
Syt2
- Application
-
Alternative Names
Syt2;Synaptotagmin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N9I0
-
Expression Region
1-419aa
-
AA Sequence
MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Syt2 (Synaptotagmin 2) is a member of the synaptotagmin family of proteins, which play crucial roles in calcium-dependent exocytosis and neurotransmitter release in neurons. Research on Syt2 has garnered significant interest due to its pivotal function in synaptic transmission and its potential implications in understanding various neurological disorders. Syt2 binds calcium ions and facilitates the fusion of synaptic vesicles with the plasma membrane, thereby mediating the rapid release of neurotransmitters. While the fundamental role of Syt2 in neurotransmission has been established, the specific mechanisms of its interactions with other proteins and its regulatory pathways are still not fully understood. Recent advances in structural biology, including cryo-electron microscopy and X-ray crystallography, have provided insights into its functional domains and conformational changes upon calcium binding. Additionally, studies have linked dysregulation of Syt2 to conditions such as autism spectrum disorders and certain forms of epilepsy, highlighting the necessity of delineating its molecular mechanisms. The recombinant expression of Syt2 protein enables detailed biochemical characterization and functional assays, which are essential for elucidating its role in synaptic function. This research not only contributes to foundational knowledge in neurobiology but also holds promise for therapeutic strategies targeting synaptic dysfunctions associated with neurological diseases. Understanding Syt2's molecular dynamics and interactions could pave the way for innovative approaches in treating synaptic impairment, making it a focal point of contemporary neuroscience research.











