Cat: PA2000-9602

Recombinant Human NARG1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NARG1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    N-alpha-acetyltransferase 15. NatA auxiliary subunit. Gastric cancer antigen Ga19. N-terminal acetyltransferase. NMDA receptor-regulated protein 1. Protein tubedown-1. Tbdn100

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BXJ9

  • Expression Region

    764-862   aa

  • AA Sequence

    HRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEEL

  • Molecular Weight

    36.63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NARG1, or N-terminal ARF-GAP-1, is a protein that plays a crucial role in various cellular processes, including membrane trafficking and signal transduction. Recent studies have highlighted its potential impact on cellular homeostasis and its involvement in disease mechanisms, particularly in cancer and neurological disorders. The reconstitution of NARG1 as a recombinant protein has become essential for understanding its structure-function relationship and its interactions with other cellular components. By producing NARG1 in a controlled setting, researchers can investigate its biochemical properties, including its binding affinity and activity in cellular pathways. This recombinant approach also allows for the exploration of post-translational modifications, which are vital for the protein's functional regulation. Overall, the study of NARG1 as a recombinant protein is pivotal in elucidating its biological significance and therapeutic potential, paving the way for the development of novel strategies targeting its associated pathways in disease interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US