Analytical Data
-
Gene name
ME2
- Application
-
Alternative Names
ME2;MEL18;RNF110;ZNF144;Polycomb group RING finger Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23368
-
Expression Region
19-584aa
-
AA Sequence
MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH
-
Molecular Weight
64.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ME2, or Malic Enzyme 2, is an important mitochondrial enzyme implicated in various metabolic processes, particularly in the conversion of malate to pyruvate while generating NADPH. This enzyme is crucial for cellular respiration and energy production, as well as for providing reducing power for biosynthetic pathways. Recent studies have highlighted the potential role of ME2 in cancer metabolism, where it may facilitate the rapid proliferation of tumor cells by supporting increased anabolic processes and maintaining redox balance. Additionally, alterations in ME2 expression have been linked to different pathophysiological conditions, including metabolic disorders and cardiovascular diseases. The recombinant expression of ME2 has allowed for detailed biochemical characterizations and structural studies, providing insights into its enzymatic mechanisms and regulatory features. Such studies are essential not only for understanding basic metabolic functions but also for identifying potential therapeutic targets for diseases associated with dysregulated metabolism. Understanding the structure and function of ME2 through recombinant technology holds promise for drug development and for devising metabolic engineering strategies to manipulate cellular pathways for various applications, including cancer therapy and metabolic disease management.











