Analytical Data
-
Gene name
NPPA
- Application
-
Alternative Names
NPPA；MURC；Caveolae-associated Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01160
-
Expression Region
78-115aa
-
AA Sequence
PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL
-
Molecular Weight
5.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPPA (Natriuretic Peptide A), also known as atrial natriuretic peptide (ANP), plays a crucial role in cardiovascular homeostasis and fluid balance. Discovered in the 1980s, NPPA is predominantly secreted by the atria of the heart in response to increased arterial tension and volume overload. Its primary functions include promoting vasodilation, regulating sodium excretion, and inhibiting renin-angiotensin-aldosterone system activity, making it vital for managing hypertension and heart failure. Due to its significant physiological roles, NPPA has been a subject of intense research aimed at understanding its structure, function, and potential therapeutic applications. Advances in recombinant DNA technology have enabled the production of NPPA as a recombinant protein, facilitating detailed studies on its therapeutic viability and interaction with its receptor, NPR-A (Natriuretic Peptide Receptor A). Research into NPPA's biomolecular properties and its involvement in pathological conditions has opened avenues for novel treatments, including the possibility of using NPPA or its analogs as a therapeutic agent in cardiovascular diseases. Given the increasing global prevalence of heart-related disorders, the exploration of NPPA as a biomarker and therapeutic target remains a promising and active area of investigation in biomedical research.
