Cat: PA1000-2876

Recombinant Human SEPT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SEPT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SEPTIN3;SEP3;SEPT3;Neuronal-specific septin-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UH03

  • Expression Region

    1-358aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSKGLPETRTDAAMSELVPEPRPKPAV PMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTL VNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTP GFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYF ISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKE LEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRV LGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAK RLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SEPT3, a member of the septin protein family, has garnered significant attention in recent years due to its pivotal role in various cellular processes, including cytokinesis, apoptosis, and cytoskeletal dynamics. Septins are GTP-binding proteins that form filamentous structures and serve as scaffolding components at the sites of cell division and in the regulation of cellular organization. The research on SEPT3 is particularly intriguing because it is implicated in the maintenance of neuronal morphology and function, which is crucial for neurodevelopment and synaptic transmission. Abnormalities in SEPT3 expression have been associated with neurodegenerative diseases, positioning it as a potential biomarker for such conditions. Additionally, SEPT3 has been identified as a critical player in the formation and stability of certain protein complexes, making it a candidate for targeted therapeutic interventions. Understanding the structure and function of SEPT3 through recombinant protein studies could provide insights into its mechanisms of action and its interactions with other cellular components, paving the way for novel strategies in the treatment of related diseases. Therefore, studying SEPT3 in depth may reveal important therapeutic avenues and contribute to a broader understanding of cellular dynamics in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US