Cat: PA1000-2927

Recombinant Human SIRPA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SIRPA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD47;MER6;Leukocyte surface antigen CD47

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78324

  • Expression Region

    31-370aa

  • AA Sequence

    EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIY NQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPD DVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYP QRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLT CQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNER

  • Molecular Weight

    64 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SIRPA (Innate Immune Receptor Protein A) is a crucial receptor predominantly expressed on myeloid cells, playing a significant role in the regulation of immune responses. This receptor mediates various cellular processes, including phagocytosis and the regulation of immune signaling pathways, particularly through its interaction with the CD47 "don't eat me" signal, which inhibits macrophage-mediated phagocytosis of self-cells. Recent studies have highlighted the potential of SIRPA as a therapeutic target in cancer immunotherapy, as blocking the CD47-SIRPA interaction can enhance the clearance of tumor cells by the immune system. Furthermore, the understanding of SIRPA's structural biology and its downstream signaling mechanisms is essential for the development of engineered SIRPA proteins or antibodies that can boost anti-tumor immunity. By investigating the recombinant SIRPA protein, researchers aim to elucidate its functional properties and further explore its applications in both basic immunology and clinical settings. The insightful manipulation of SIRPA could pave the way for next-generation treatments that not only enhance immune responses against cancer but also mitigate the immunosuppressive environments often created by tumors. Such advancements could lead to more effective therapies in cancer treatment, significantly improving patient outcomes in oncology. As a result, the study of SIRPA and its recombinant forms stands at the forefront of contemporary immunological research, offering promising avenues for innovative therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US