Analytical Data
-
Gene name
ACAD10
- Application
-
Alternative Names
ACAD10; Acyl-CoA dehydrogenase family member 10
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal.
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6JQN1
-
Expression Region
1-237aa
-
AA Sequence
MGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL
-
Molecular Weight
52.8 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ACAD10, a member of the acyl-CoA dehydrogenase family, has garnered significant attention due to its crucial role in fatty acid metabolism and energy production within mitochondria. Mutations in the ACAD10 gene have been linked to various metabolic disorders, including those affecting lipid metabolism and mitochondrial function. Research indicates that ACAD10 is involved in the oxidation of long-chain fatty acids, and its dysfunction can lead to an accumulation of toxic metabolites, potentially resulting in cellular damage and contributing to the development of diseases such as cardiomyopathy and other metabolic conditions. Additionally, ACAD10 has been implicated in the regulation of oxidative stress and inflammation, further highlighting its importance in maintaining cellular homeostasis. As researchers aim to elucidate the molecular mechanisms underlying ACAD10's function, recombinant ACAD10 protein production has become essential for detailed biochemical characterization and the development of potential therapeutic strategies. Investigating the structure-function relationship of ACAD10 through recombinant protein studies may pave the way for novel interventions in managing associated metabolic disorders, improving our understanding of its role in human health and disease.
