Analytical Data
-
Gene name
SMNDC1
- Application
-
Alternative Names
SMNDC1;SMNR;SPF30;Survival of motor neuron-related-splicing factor 30
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75940
-
Expression Region
1-238aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSEDLAKQLASYKAQLQQVEAALSGNGENE DLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCM AVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRK AKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQ FNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKY NVRHLMPQ
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMNDC1, or Survival of Motor Neuron Domain Containing 1, is a protein that plays a crucial role in the assembly of spliceosomal snRNPs (small nuclear ribonucleoproteins), which are essential for pre-mRNA splicing, a fundamental process in gene expression regulation. Mutations in the SMN1 gene lead to spinal muscular atrophy (SMA), a severe neurodegenerative disorder characterized by the loss of motor neurons and muscle weakness. The discovery of SMNDC1 has emerged as an important area of research, particularly due to its potential therapeutic implications in SMA and other neurological conditions. Understanding the structure, function, and interactions of SMNDC1 can provide insights into the molecular mechanisms underlying splicing and neurodegeneration. Furthermore, the production of recombinant SMNDC1 protein allows for biochemical studies, high-throughput screening for small molecules, and identification of potential drug targets. The investigation of SMNDC1 has the potential to not only advance our comprehension of RNA biology but also pave the way for developing novel interventions in diseases linked to splicing defects, presenting a promising frontier in molecular medicine and therapeutics.
