Cat: PA2000-1491

Recombinant Human AMOTL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AMOTL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AMOTL2;KIAA0989;Angiomotin-like Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y2J4

  • Expression Region

    314-779aa

  • AA Sequence

    MEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLT RASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQ AGSQDMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALG NAQGRAARAEEELRKKQAYVEKVERLQQALGQLQAACEKREQLELRLRTR LEQELKALRAQQRQAGAPGGSSGSGGSPELSALRLSEQLREKEEQILALE ADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNE GLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLR PAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTA PPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSV ATSRVQDLSDMVEILI

  • Molecular Weight

    78 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PCDHa4 (Protocadherin Alpha 4) is a member of the protocadherin gene family, which plays a crucial role in neuronal development and synaptic function. This protein is characterized by its unique structure, featuring multiple extracellular cadherin-like domains that facilitate homophilic interactions between adjacent neurons. Research has shown that PCDHa4 is involved in the establishment of specific neuronal connections, which are vital for proper brain function. Dysregulation or mutations in PCDHa4 have been implicated in various neurological disorders, including autism spectrum disorders and schizophrenia. Consequently, understanding the molecular mechanisms by which PCDHa4 contributes to neuronal networking is essential for developing potential therapeutic strategies for these conditions. Recombinant PCDHa4 protein serves as a valuable tool for studying its biological functions and interactions in vitro, allowing researchers to dissect the role of this protein in cell adhesion, signaling pathways, and overall neuronal health. Investigating PCDHa4 through recombinant protein techniques can also aid in the identification of potential binding partners and elucidate the pathways influenced by this protocadherin, advancing our comprehension of its contributions to synaptic plasticity and neural circuit formation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US