Analytical Data
-
Gene name
ADAR
- Application
-
Alternative Names
ADAR；ADAR1；DSRAD；G1P1；Double-stranded RNA-specific adenosine deaminase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55265
-
Expression Region
1-176aa
-
AA Sequence
MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL
-
Molecular Weight
48.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADAR proteins, or Adenosine Deaminases Acting on RNA, are crucial enzymes involved in the editing of RNA molecules, specifically converting adenosine (A) into inosine (I) in double-stranded RNA (dsRNA). This post-transcriptional modification plays significant roles in various biological processes, including the regulation of gene expression, the immune response, and the generation of protein diversity. ADAR proteins are particularly important in the context of neurological function and are implicated in numerous diseases, including viral infections and neurodegenerative disorders. Research has shown that abnormalities in ADAR activity can lead to dysregulation of RNA editing, contributing to conditions such as cancer and autoimmune diseases. The study of ADAR proteins and their mechanisms is vital for understanding their multifaceted roles in cellular physiology and disease pathology. Researchers are increasingly focused on the therapeutic potential of targeting ADAR activity, either by enhancing or inhibiting its function, to develop innovative treatments for these conditions. As the molecular characterization of ADAR proteins progresses, there is a growing interest in their application in gene therapy, precision medicine, and the development of RNA-based therapeutics. This unique RNA editing capability positions ADAR proteins as promising tools in biotechnology, further driving research into their structure, function, and regulation in various biological contexts.
