Analytical Data
-
Gene name
PLET1
- Application
-
Alternative Names
PLET1；C11orf34；Placenta-expressed transcript 1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UQ28
-
Expression Region
26-187aa
-
AA Sequence
TFIRYSSTCFTFDEYYTITLDIKASSHIYESNAVYSVFVPVNDSVYAVVMKTLDENSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQAFTVQIRALPILSTLKLREKLSTLALAAKIPQSSAFKPFFMITPKSIRLEGLANQVFS
-
Molecular Weight
24.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLET1, or prostaglandin E2 synthase-like protein 1, is a member of the lipocalin protein family and has garnered attention due to its potential roles in various physiological and pathological processes. Research indicates that PLET1 may be involved in regulating immune responses, cell signaling, and inflammation, which are crucial in numerous diseases, including cancer and autoimmune disorders. Its expression has been observed in various tissues, suggesting a potential role in tissue-specific functions. Moreover, the ability to manipulate PLET1 through recombinant protein technology has opened avenues for investigating its structure-function relationship, interactions with other biomolecules, and overall biological significance. Understanding PLET1 at a molecular level could pave the way for novel therapeutic strategies targeting inflammation and immune-related diseases. As such, the study of PLET1 recombinant protein not only enhances our comprehension of this protein’s biological roles but also holds promise for advancing medical research and treatment options in relevant fields.
