Analytical Data
-
Gene name
CD99
- Application
-
Alternative Names
CD99；MIC2；CD99 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14209
-
Expression Region
23-122aa
-
AA Sequence
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNP PKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD VDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD99, a cell surface glycoprotein encoded by the PAX gene family, plays a significant role in various biological processes, including cell adhesion, migration, and immune responses. It is predominantly expressed in leukocytes and endothelial cells and is involved in the pathophysiology of several diseases, particularly in hematological malignancies and autoimmune disorders. Research has demonstrated that CD99 influences T-cell activation and may modulate apoptosis in certain immune contexts. Moreover, it has been identified as a potential therapeutic target due to its involvement in tumor progression and metastasis in various cancers. The recombinant CD99 protein has become a focal point of study, as it offers a means to understand the molecular mechanisms underlying these biological activities and to explore its potential utility in diagnostics and targeted therapies. Investigations into the structure-function relationships of CD99, along with its interactions with other cellular proteins, can provide insight into its role in disease mechanisms. Furthermore, recombinant forms of CD99 can be used in the development of monoclonal antibodies and other biopharmaceuticals, paving the way for novel treatment strategies in cancer and inflammatory diseases. Overall, the research into CD99 recombinant proteins represents a promising avenue for advancing our understanding of immune regulation and enhancing therapeutic interventions in various disease contexts.
