Cat: PA1000-4395

Recombinant Human ANXA2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANXA2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ANXA2;ANX2;ANX2L4;CAL1H;Annexin A2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07355

  • Expression Region

    2-339aa

  • AA Sequence

    STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGV DEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILG LLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMY KTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDA GVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGD LENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDML KIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANXA2 (Annexin A2) has garnered significant interest in biomedical research due to its multifaceted role in various cellular processes, including cell signaling, membrane trafficking, and cytoskeletal dynamics. This calcium-dependent phospholipid-binding protein is implicated in several critical physiological and pathological processes, such as cell proliferation, differentiation, and apoptosis. Additionally, ANXA2 is known to be involved in tumor biology, where it is associated with cancer progression, invasion, and metastasis. Notably, it serves as a receptor for certain viruses, suggesting its importance in infectious diseases. The study of ANXA2 recombinant proteins provides valuable insights into its structure-function relationships and potential therapeutic applications. The expression and purification of ANXA2 in recombinant systems allow researchers to examine its interactions with other proteins, elucidate its role in cellular mechanisms, and explore its potential as a biomarker or therapeutic target. Furthermore, understanding the functional aspects of ANXA2 can contribute to the development of novel strategies for cancer treatment and the management of viral infections, underscoring its relevance in both fundamental and applied research realms. As such, ANXA2 recombinant proteins serve as critical tools in advancing our knowledge of this multifunctional protein and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US