Analytical Data
-
Gene name
CD247
- Application
-
Alternative Names
CD247；CD3Z；T3Z；TCRZ；T-cell surface glycoProtein CD3 zeta chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20963
-
Expression Region
62-164aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSRVKFSRSADAPAYQQGQNQLYNELNLG RREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGM KGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD247, also known as CD3ζ, is a crucial component of the T cell receptor (TCR) complex, playing a vital role in T cell activation and signaling. It serves as an essential adaptor protein that transmits activation signals following antigen recognition. Dysregulation of CD247 expression or function has been implicated in various immunological disorders, including autoimmune diseases and cancer. Research into CD247 recombinant proteins aims to elucidate its functional mechanisms, optimize T cell responses, and explore its potential as a therapeutic target. Recent studies have highlighted the importance of CD247 in modulating immune responses, demonstrating that enhanced CD247 engagement can amplify T cell activity against tumors. Moreover, engineering CD247-derived constructs could pave the way for innovative immunotherapies, such as CAR-T cell therapies, that harness T cell potential more effectively. Consequently, understanding the structure and function of CD247 recombinant proteins is imperative for advancing therapeutic strategies that leverage the immune system in combating diseases. This research area holds promise not only for developing novel cancer treatments but also for addressing various immune-mediated conditions by fine-tuning T cell responses through targeted modulation of CD247.
